PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A06G0740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 458aa    MW: 51889.5 Da    PI: 7.9475
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A06G0740genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix99.52.9e-31340424186
     trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                  rW++ ev aLi++r ++e ++r+  lk+p Weevs++m++ g++rs+k+Ckekwen+nk+++k ke+ kkr +++s+tc yf+ql+
  Gh_A06G0740 340 RWPRAEVEALIQVRCDLEAKFREPGLKGPVWEEVSSFMASLGYQRSAKRCKEKWENINKYFRKSKENGKKR-CRHSKTCTYFHQLD 424
                  8*******************************************************************997.*************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.771337397IPR017877Myb-like domain
PfamPF138376.2E-21339426No hitNo description
CDDcd122036.33E-27339404No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MQPVKYGAQN LQERLTEEDG YSSVFSISNS LHCQQLFQQN LGPLTHQLLL HQHQFQQPNS  60
AVGFKLGLDE ISMKKEAVLA LNHPQQNGND QPSLLAPHCW HPQEDSPIKQ PFWKSLNRCD  120
EDSIRQCTSE RSKHLDNKYR FFGELEAIYG LGGETTQAGS GSAVTGENYS PANEGIPMPS  180
TEFQGHNVGA NGRGDNVTTG VDHGSEGSIG EQASLRKIQK KKRKKKMKEQ LCSMLVFFET  240
LVKQVMDHQE GLHKRFLEVI ETMDKERSAK EESWRQREAE KRKNEAIARA NEQALASNRE  300
AVIVSYLEKL TGQSINLPPR TPLLVQPESA MVPLNDNNSR WPRAEVEALI QVRCDLEAKF  360
REPGLKGPVW EEVSSFMASL GYQRSAKRCK EKWENINKYF RKSKENGKKR CRHSKTCTYF  420
HQLDQLYSRM LPTTCPTSPP SPLINNDIDL PDTELGAA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1214223LRKIQKKKRK
2218225QKKKRKKK
3219225KKKRKKK
4220224KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012452359.10.0PREDICTED: trihelix transcription factor GTL1-like
TrEMBLA0A0B0NUX70.0A0A0B0NUX7_G
STRINGPOPTR_0018s05520.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16469813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.22e-50Trihelix family protein